WH0000639M1
Monoclonal Anti-PRDM1 antibody produced in mouse
clone 2B10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-BLIMP1, Anti-MGC118922, Anti-MGC118923, Anti-MGC118924, Anti-MGC118925, Anti-PR domain containing 1, with ZNF domain, Anti-PRDIBF1
Select a Size
CA$106.00
Select a Size
About This Item
CA$106.00
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2B10, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
1 of 4
This Item | WHA2630990 | WHA2626990 | WHA2628990 |
---|---|---|---|
detection method colorimetric | detection method colorimetric | detection method colorimetric | detection method colorimetric |
feature pH Indicators, Integral Comparison Strip, 1.0 to 12.0 range | feature pH Indicators, Integral Comparison Strip, 8.0 to 9.7 range | feature pH Indicators, Integral Comparison Strip, 1.8 to 3.8 range | feature pH Indicators, Integral Comparison Strip, 5.2 to 6.8 range |
packaging pkg of 200 ea | packaging pkg of 200 ea | packaging pkg of 200 ea | packaging pkg of 200 ea |
manufacturer/tradename Whatman 2612-990 | manufacturer/tradename Whatman 2630-990, Whatman Article No. 28418930 (US reference) | manufacturer/tradename Whatman 2626-990, Whatman Article No. 28418926 (US reference) | manufacturer/tradename Whatman 2628-990, Whatman Article No. 28418928 (US reference) |
W × L 11 mm × 100 mm | W × L 11 mm × 100 mm | W × L 11 mm × 100 mm | W × L 11 mm × 100 mm |
General description
Immunogen
Sequence
MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
Features and Benefits
Physical form
Legal Information
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service