Accéder au contenu
Merck

Passer à

MSST0005

Sigma-Aldrich

SILuProt VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonyme(s) :

SILuProt Vascular endothelial growth factor A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

Sélectionner une taille de conditionnement

Changer de vue

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in HEK 293 cells

Essai

≥95% (SDS-PAGE)

Forme

lyophilized powder

Technique(s)

mass spectrometry (MS): suitable

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... VEGFA(7422)

Description générale

SILu Prot VEGF165 is a recombinant, stable isotope-labeled human VEGF165 which incorporates [13C6,15N4]−Arginine and [13C6, 15N2]−Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of VEGF165 by mass-spectrometry.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Actions biochimiques/physiologiques

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure1. VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration2.
VEGF has also been implicated in correlation with poor prognosis in breast cancer2. In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4.

Séquence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice),1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique