SAB1404480
Monoclonal Anti-TNF antibody produced in mouse
clone M1-C4, purified immunoglobulin, buffered aqueous solution
Select a Size
₹24,040.00
Select a Size
About This Item
₹24,040.00
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
M1-C4, monoclonal
form
buffered aqueous solution
mol wt
antigen ~51.74 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
1 of 4
This Item | Z640921 | Z640883 | Z641111 |
---|---|---|---|
material beaded neck tube, polypropylene , round bottom tube, cylindrical tube | material beaded neck tube, cylindrical tube, polypropylene , round bottom tube | material beaded neck tube, cylindrical tube, polypropylene , round bottom tube | material beaded neck neck, cylindrical polypropylene tube, round bottom bottom |
manufacturer/tradename BRAND 115354 | manufacturer/tradename BRAND 115352 | manufacturer/tradename BRAND 115342 | manufacturer/tradename BRAND 115356 |
packaging pack of 20 ea | packaging pack of 20 ea | packaging pack of 250 ea | packaging pack of 10 ea |
capacity 110 mL | capacity 75 mL | capacity 10 mL | capacity 125 mL |
feature autoclavable at 121°C and withstand RCF of up to 5,000 × g | feature autoclavable at 121°C and withstand RCF of up to 5,000 × g, without cap | feature autoclavable at 121°C and withstand RCF of up to 5,000 × g, without cap | feature autoclavable at 121°C and withstand RCF of up to 5,000 × g, without cap |
sterility non-sterile | sterility non-sterile | sterility non-sterile | sterility non-sterile |
General description
Immunogen
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Physical form
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service