WH0000081M1
Monoclonal Anti-ACTN4 antibody produced in mouse
clone 4D10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-FSGS, Anti-FSGS1, Anti-actinin, alpha 4
About This Item
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4D10, monoclonal
form
buffered aqueous solution
species reactivity
mouse, rat, human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
1 of 4
This Item | MABS1995M | MABS2036M | SAB4501927 |
---|---|---|---|
Gene Information human ... MT-ND2(4536) | Gene Information human ... MT-ATP6(4508) | Gene Information human ... MT-CYB(4519) | Gene Information human ... MT-ND1(4535) |
biological source mouse | biological source mouse | biological source mouse | biological source rabbit |
species reactivity human | species reactivity human | species reactivity human | species reactivity human |
clone 9E12-1B3, monoclonal | clone 1G7-1G2, monoclonal | clone 5B3-6E3, monoclonal | clone polyclonal |
antibody form purified antibody | antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form affinity isolated antibody |
technique(s) western blot: suitable | technique(s) western blot: suitable | technique(s) western blot: suitable | technique(s) ELISA: 1:40000, immunohistochemistry: 1:50-1:100, western blot: 1:500-1:1000 |
General description
Immunogen
Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Features and Benefits
Physical form
Legal Information
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service