Skip to Content
MilliporeSigma

Skip To

WH0000081M1

Sigma-Aldrich

Monoclonal Anti-ACTN4 antibody produced in mouse

clone 4D10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FSGS, Anti-FSGS1, Anti-actinin, alpha 4

Sign Into View Organizational & Contract Pricing

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4D10, monoclonal

form

buffered aqueous solution

species reactivity

mouse, rat, human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MABS1995MMABS2036MSAB4501927
Gene Information

human ... MT-ND2(4536)

Gene Information

human ... MT-ATP6(4508)

Gene Information

human ... MT-CYB(4519)

Gene Information

human ... MT-ND1(4535)

biological source

mouse

biological source

mouse

biological source

mouse

biological source

rabbit

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

human

clone

9E12-1B3, monoclonal

clone

1G7-1G2, monoclonal

clone

5B3-6E3, monoclonal

clone

polyclonal

antibody form

purified antibody

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

affinity isolated antibody

technique(s)

western blot: suitable

technique(s)

western blot: suitable

technique(s)

western blot: suitable

technique(s)

ELISA: 1:40000, immunohistochemistry: 1:50-1:100, western blot: 1:500-1:1000

General description

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. (provided by RefSeq)

Immunogen

ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

  • Choose from one of the most recent versions:

    Certificates of Analysis (COA)

    Lot/Batch Number

    Don't see the Right Version?

    If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

    Already Own This Product?

    Find documentation for the products that you have recently purchased in the Document Library.

    Visit the Document Library

    Customers Also Viewed

    Differential derivative spectrophotometric determination of phenobarbitone and phenytoin sodium in combined tablet preparations
    Prasad CVN, et al.
    Talanta, 44(5), 917-922 (1997)
    Method Development and Validation of Phenytoin Sodium in bulk and its Pharmaceutical dosage form by RP-HPLC method
    Varaprasad A, et al.
    International Journal of Biological & Pharmaceutical Research, 3(5), 126-129 (2012)
    Zin-Juan Klaft et al.
    Neuropharmacology, 176, 108213-108213 (2020-07-03)
    Status epilepticus (SE) is a neurological emergency characterized by continuous seizure activity lasting longer than 5 min, often with no recovery between seizures (Trinka et al., 2015). SE is refractory to benzodiazepine and second-line treatments in about 30% cases. Novel treatment
    Maria B Rabaglino et al.
    BMC genomics, 15, 1001-1001 (2014-11-21)
    Major changes in gene expression occur in the fetal brain to modulate the function of this organ postnatally. Thus, factors can alter the genomics of the fetal brain, predisposing to neurological disorders later in life. We hypothesized that the physiological
    Misty Good et al.
    American journal of physiology. Gastrointestinal and liver physiology, 306(11), G1021-G1032 (2014-04-20)
    Necrotizing enterocolitis (NEC) is the leading cause of death from gastrointestinal disease in premature infants and develops partly from an exaggerated intestinal epithelial immune response to indigenous microbes. There has been interest in administering probiotic bacteria to reduce NEC severity

    Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

    Contact Technical Service