AV48819

Anti-TRMU antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-MGC99627, Anti-MTO2, Anti-MTU1, Anti-TRMT, Anti-TRMT1, Anti-TRNT1, Anti-tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 48 kDa
• 종 반응성: mouse, human, rat, bovine, guinea pig, rabbit
• 농도: 0.5 mg - 1 mg/mL

설명

일반 설명

TRMU codes for tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase that catalyzes the 2-thiolation of uridine. Studies have reported that TRMU mutations affect the deafness-associated mutations in 12S ribosomal RNA.
Rabbit Anti-TRMU antibody recognizes bovine, canine, human, mouse, and rat TRMU.

면역원

Synthetic peptide directed towards the C terminal region of human TRMU

애플리케이션

Rabbit Anti-TRMU antibody is suitable for western blot applications at a concentration of 1μg/ml.

생화학적/생리학적 작용

TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

서열

Synthetic peptide located within the following region: ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable