SAB2100714
Anti-ESRRA antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-ERRα, Anti-ERR1, Anti-ERRa, Anti-ESRL1, Anti-Estrogen-related receptor α
Sign Into View Organizational & Contract Pricing
Select a Size
Change View
1 G
MYR 1,625.00
About This Item
MYR 1,625.00
Check Cart for Availability
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
46 kDa
species reactivity
bovine, human, horse, mouse, yeast, rat, guinea pig
concentration
0.5 mg - 1 mg/mL
1 of 4
This Item | SMB00424 | 53889 | 1048233 |
|---|---|---|---|
| form powder | form powder | form - | form - |
| assay ≥98% (HPLC) | assay ≥98% (HPLC) | assay ≥95% (HPLC) | assay - |
| Quality Level 100 | Quality Level 200 | Quality Level 100 | Quality Level - |
| storage temp. −20°C | storage temp. 2-8°C | storage temp. - | storage temp. 2-8°C |
| solubility H2O: 3 mg/mL, clear (warmed) | solubility - | solubility - | solubility - |
| storage condition desiccated | storage condition - | storage condition - | storage condition - |
Immunogen
Synthetic peptide directed towards the N terminal region of human ESRRA
Biochem/physiol Actions
ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.The protein encoded by this gene is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes. A processed pseudogene of ESRRA is located on chromosome 13q12.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Sequence
Synthetic peptide located within the following region: KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Keith C Meyer et al.
The European respiratory journal, 44(6), 1479-1503 (2014-11-02)
Bronchiolitis obliterans syndrome (BOS) is a major complication of lung transplantation that is associated with poor survival. The International Society for Heart and Lung Transplantation, American Thoracic Society, and European Respiratory Society convened a committee of international experts to describe
Sarah E Burr et al.
Bulletin of the World Health Organization, 92(7), 490-498 (2014-08-12)
To evaluate the effect of repeated mass drug administration (MDA) of azithromycin in the Gambia on the nasopharyngeal carriage of Streptococcus pneumoniae and on the emergence of antibiotic-resistant strains. This study involved villages that participated in a cluster randomized trial
Katharina Krenn et al.
The Journal of thoracic and cardiovascular surgery, 149(4), 1194-1202 (2015-01-18)
Azithromycin has become a standard of care in therapy of bronchiolitis obliterans following lung transplantation. Matrix metalloprotease-9 broncho-alveolar lavage levels increase in airway neutrophilia and bronchiolitis obliterans. Interleukin-17 may play a role in lung allograft rejection, and interleukin-12 is downregulated
Alison M Binder et al.
American journal of respiratory and critical care medicine, 188(7), 807-812 (2013-08-10)
Persons with cystic fibrosis (CF) are at high risk of nontuberculous mycobacterial (NTM) infection, with treatment requiring prolonged multidrug regimens that include macrolides. Although macrolides, specifically azithromycin, are used in the management of patients with CF with chronic Pseudomonas, macrolide-resistant
Josje Altenburg et al.
JAMA, 309(12), 1251-1259 (2013-03-28)
Macrolide antibiotics have been shown beneficial in cystic fibrosis (CF) and diffuse panbronchiolitis, and earlier findings also suggest a benefit in non-CF bronchiectasis. To determine the efficacy of macrolide maintenance treatment for adults with non-CF bronchiectasis. The BAT (Bronchiectasis and
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service