WH0026502M3
Monoclonal Anti-NARF antibody produced in mouse
clone 7D9, ascites fluid
Synonym(s):
Anti-DKFZp434G0420, Anti-FLJ10067, Anti-nuclear prelamin A recognition factor
Select a Size
MYR 1,793.00
Select a Size
About This Item
MYR 1,793.00
Recommended Products
1 of 4
This Item | WH0004677M1 | HPA040851 | WH0009986M6 |
---|---|---|---|
clone 7D9, monoclonal | clone 2D6, monoclonal | clone polyclonal | clone 6A6, monoclonal |
biological source mouse | biological source mouse | biological source rabbit | biological source mouse |
conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
antibody form ascites fluid | antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form purified immunoglobulin |
species reactivity human | species reactivity human | species reactivity human | species reactivity human |
Gene Information human ... NARF(26502) | Gene Information human ... NARS(4677) | Gene Information human ... NARFL(64428) | Gene Information human ... RCE1(9986) |
General description
Immunogen
Sequence
MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCP
Physical form
Legal Information
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service