Skip to Content
MilliporeSigma
Sign Into View Organizational & Contract Pricing

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

conjugate

unconjugated

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

rabbit, mouse, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CYBB(1536)

Looking for similar products? Visit Product Comparison Guide

General description

Cytochrome b-245 is a major component of the microbicidal oxidase system of human leucocytes including eosinophils, monocytes, macrophages and neutrophils. Cytochrome b-245 is thought to be the terminal component of the microbicidal oxidase electron transport chain leading to the respiratory burst of phagocytic neutrophil cells which generates superoxide-free radials. Defects in cytochrome b-245 have been linked to chronic granulomatous disease.

Specificity

Anti-CγBB polyclonal antibody reacts with human, mouse, rat, bovine, chicken, rabbit, and canine cytochrome b-245 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human CY24B

Application

Anti-CγBB polyclonal antibody is used to tag cytochrome b-245 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome b-245 in microbicidal oxidase respiratory burst of phagocytic cells.

Biochem/physiol Actions

Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.

Sequence

Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service