The interleukin 11 (IL11) gene, with five exons spanning 7kb of genomic DNA, is mapped to human chromosome 19q13.42. The encoded protein belongs to the IL-6 family of cytokines. IL-11 is secreted by activated astrocytes.

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. (provided by RefSeq)

IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein.

Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Interleukin 11 (IL11) stimulates tumorigenesis in conjunction with angiogenesis of the primary tumor and of metastatic progenies at distant organs. IL-11 signaling is considered as a rate-limiting step for the tumorigenesis in the mucosa of the gastrointestinal tract. Thus, inhibition of IL-11 signaling can be considered as an emerging therapeutic strategy for various cancers. In addition, this protein also performs a protective role by increasing platelet recovery and inflammatory responses, in sepsis patients with thrombocytopenia. Mutation in the gene increases the risk of susceptibility to Hirschsprung disease and multiple sclerosis (MS).

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.