WH0005156M1
Monoclonal Anti-PDGFRA antibody produced in mouse
clone 2D2-1A11, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-CD140A, Anti-MGC74795, Anti-PDGFR2, Anti-platelet-derived growth factor receptor, alpha polypeptide
About This Item
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2D2-1A11, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
1 of 4
This Item | SAB1412471 | SAB1412666 | SAB1412667 |
---|---|---|---|
Gene Information human ... RUNX1(861) | Gene Information human ... RUNX1(861) | Gene Information human ... RUNX2(860) | Gene Information human ... RUNX2(860) |
clone 3A8, monoclonal | clone 3A1, monoclonal | clone 1D2, monoclonal | clone 3F5, monoclonal |
antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified immunoglobulin |
species reactivity human | species reactivity human | species reactivity human | species reactivity human |
biological source mouse | biological source mouse | biological source mouse | biological source mouse |
conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
General description
Platelet-derived growth factor receptor α (PDGFRA) is also termed as cluster of differentiation 140a (CD140a). It is is encoded by the gene mapped to human chromosome 4q12. The encoded protein belongs to the receptor tyrosine kinase gene family.
Immunogen
Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Biochem/physiol Actions
Physical form
Legal Information
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Related Content
The Yu program centers around the discovery of catalytic carbon–carbon and carbon–heteroatom bond forming reactions based on C–H activation. Target transformations are selected to enable 1) the use of simple and abundant starting materials such as aliphatic acids, amines and alcohols, and 2) disconnections that drastically shorten the synthesis of a drug molecule or a major class of biologically active compounds.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service