Skip to Content
MilliporeSigma

Skip To

SAB2102267

Sigma-Aldrich

Anti-SOX17 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FLJ22252, Anti-SRY (sex determining region Y)-box 17

Sign Into View Organizational & Contract Pricing

Select a Size

3 EA
$40.70

$40.70


Please contact Customer Service for Availability

Select a Size

Change View
3 EA
$40.70

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$40.70


Please contact Customer Service for Availability

Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human SOX17

Biochem/physiol Actions

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Sequence

Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Oxidative conversion of thiourea and N-substituted thioureas into formamidine disulfides with acidified chloramine-T: a kinetic and mechanistic approach
Shubha J, et al.
Journal of Sulfur Chemistry, 30, 490-499 (2009)
Microwave assisted solvent-free synthesis of N-phenyl-4-(pyridin-4-yl) thiazoles and their drug-likeness studies
Kukade M, et al.
Journal of the Indian Chemical Society, 99, 100509-100509 (2022)
Solvent-free synthesis of luminescent copper (I) coordination polymers with thiourea derivatives
Grifasi F, et al.
Crystal Growth & Design, 15, 2929-2939 (2015)
Stephen Wooding et al.
Chemical senses, 35(8), 685-692 (2010-06-17)
The perceived bitterness of cruciferous vegetables such as broccoli varies from person to person, but the functional underpinnings of this variation are not known. Some evidence suggests that it arises, in part, from variation in ability to perceive goitrin (5-vinyloxazolidine-2-thione)
Panagiotis Symvoulidis et al.
Nature methods, 14(11), 1079-1082 (2017-10-03)
A long-standing objective in neuroscience has been to image distributed neuronal activity in freely behaving animals. Here we introduce NeuBtracker, a tracking microscope for simultaneous imaging of neuronal activity and behavior of freely swimming fluorescent reporter fish. We showcase the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service