AV41490

Anti-Fibronectin Antibody

rabbit polyclonal

• Synonyme(s) : Fn1 Antibody, Fn1 Antibody - Anti-FN1 antibody produced in rabbit, Anti-CIG, Anti-DKFZp686F10164, Anti-DKFZp686H0342, Anti-DKFZp686I1370, Anti-DKFZp686O13149, Anti-FINC, Anti-FN, Anti-Fibronectin 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Product Name: Anti-FN1 antibody produced in rabbit, affinity isolated antibody
• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 76 kDa
• Espèces réactives: bovine, dog, sheep, pig, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_002017
• Numéro d'accès UniProt: P02751
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FN1(2335)

Description

Description générale

Fibronectins are a class of immunochemically related glycoproteins present in basement membranes, collective tissues and blood wherein they mediate adhesion between matrix components and cells. Plasma fibronectin (CLG) mediates the attachment of monocytes (fibroblasts, macrophages) to various cell matrices and materials such as gelatin.

Spécificité

Anti-FN1 polyclonal antibody reacts with human, canine, rabbit, bovine, rat, and mouse plasma fibronectin (CIG).

Immunogène

Synthetic peptide directed towards the C terminal region of human FN1

Application

Anti-FN1 polyclonal antibody is used to tag plasma fibronectin (CIG) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of fibronectin (CIG) in the adherence of monocytes to cell matricies and solid surfaces coated with materials such as gelatin.

Actions biochimiques/physiologiques

FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Séquence

Synthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable