Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV49523

Sigma-Aldrich

Anti-IL22 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-IL-21, Anti-IL-22, Anti-IL-D110, Anti-IL-TIF, Anti-IL21, Anti-ILTIF, Anti-Interleukin 22, Anti-MGC79382

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

20 kDa

Espèces réactives

rat, mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL22(50616)

Description générale

Interleukin 22 (IL-22) belongs to the IL10 family of T-cell associated cytokines, highly expressed in αβ and γδ T cells, as well as in innate lymphoid cells. Inflammatory cells associated with the thymus, pancreas, synovium, skin, and gut secrete IL-22. The Il-22 gene is localized on human chromosome 12q15.

Immunogène

Synthetic peptide directed towards the C terminal region of human IL22

Application

Anti-IL22 antibody produced in rabbit has been used in immunoblotting (1:1000).

Actions biochimiques/physiologiques

Interleukin 22 (IL-22) plays a key role in cell proliferation, cellular defense, and tissue regeneration, It shows potential in wound healing and to treat gastrointestinal (GI)-related illnesses. Higher levels of IL-22 is observed in systemic lupus erythematosus, vitiligo, multiple sclerosis, etc.
Interleukin 22 (IL22) belongs to the interleukin 10 (IL-10) family. It is a cytokine that contributes to the inflammatory response in vivo. IL22 cellular effects are mediated by a heterodimeric receptor made up of IL22 and IL-10Rβ. IL22 signaling mediates proliferation of epithelial cells during inflammation mainly by the activation of signal transducer and activator of transcription 1 (STAT1) and STAT3 signaling.

Séquence

Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique