SAB1412431

ANTI-MUC2 antibody produced in mouse

clone 3D10, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : MLP, MUC2, SMUC
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3D10, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 36.63 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_002457
• Numéro d'accès UniProt: Q02817
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MUC2(4583)

Description

Description générale

Mucin 2, oligomeric mucus/gel-forming (MUC2) is encoded by the gene mapped within 400kb on human chromosome 11p15.5. The encoded protein has a molecular mass of ~550 kDa and is expressed at high levels in the intestine and at lower levels in the respiratory tree. Mucin is a key component of mucus and it consists of one partial von Willebrand domain (vWD) at N- terminal and two complete domains including CysD domain and two proline, threonine and serine (PTS) domains that become densely O-glycosylated to form the prolonged mucin domains.

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Immunogène

MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*

Actions biochimiques/physiologiques

Mucin 2, oligomeric mucus/gel-forming (MUC2) acts as a major constituent of the two-layered mucous structure in the colon. MUC2 in the outer mucous layer provides the habitat for the commensal flora and in the stratified inner mucous layer it protects the epithelial cells from bacteria invasion. The encoded protein controls expression and antimicrobial activity of β-defensin 2. Deficiency of MUC2 mucin might lead to opportunistic microbial invasion and/or impaired innate responses.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable