Accéder au contenu
MilliporeSigma

Principaux documents

Passer à

WH0026291M1

Sigma-Aldrich

Monoclonal Anti-FGF21 antibody produced in mouse

clone 2F11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-fibroblast growth factor 21

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Le tarif et la disponibilité ne sont pas disponibles actuellement.
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2F11, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Comparer avec des articles similaires

Voir la comparaison complète

Montrer les différences

1 of 4

Cet article
AMAB91421WH0002260M3WH0002672M1
clone

2F11, monoclonal

clone

CL6491, monoclonal

clone

5E9, monoclonal

clone

3G8, monoclonal

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

biological source

mouse

biological source

-

biological source

mouse

biological source

mouse

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

human

Gene Information

human ... FGF21(26291)

Gene Information

human ... FGF21(26291)

Gene Information

human ... FGFR1(2260)

Gene Information

human ... GFI1(2672)

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

Description générale

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. (provided by RefSeq)

Immunogène

FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


  • Faites votre choix parmi les versions les plus récentes :

    Certificats d'analyse (COA)

    Lot/Batch Number

    Vous ne trouvez pas la bonne version ?

    Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

    Déjà en possession de ce produit ?

    Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

    Consulter la Bibliothèque de documents

    Jonathan R Peterson et al.
    Science translational medicine, 6(255), 255ra132-255ra132 (2014-09-26)
    Heterotopic ossification (HO) is the pathologic development of ectopic bone in soft tissues because of a local or systemic inflammatory insult, such as burn injury or trauma. In HO, mesenchymal stem cells (MSCs) are inappropriately activated to undergo osteogenic differentiation.
    Yu Fei Lee et al.
    PloS one, 9(9), e106661-e106661 (2014-09-05)
    The orchestration of histone modifiers is required to establish the epigenomic status that regulates gene expression during development. Whsc1 (Wolf-Hirschhorn Syndrome candidate 1), a histone H3 lysine 36 (H3K36) trimethyltransferase, is one of the major genes associated with Wolf-Hirshhorn syndrome
    Hai Wu et al.
    Genome biology, 15(3), R52-R52 (2014-03-25)
    Osteogenesis is a highly regulated developmental process and continues during the turnover and repair of mature bone. Runx2, the master regulator of osteoblastogenesis, directs a transcriptional program essential for bone formation through genetic and epigenetic mechanisms. While individual Runx2 gene
    Xiaoquan Zhu et al.
    PLoS genetics, 10(10), e1004589-e1004589 (2014-10-24)
    Distal arthrogryposis type 2B (DA2B) is an important genetic disorder in humans. However, the mechanisms governing this disease are not clearly understood. In this study, we generated knock-in mice carrying a DA2B mutation (K175del) in troponin I type 2 (skeletal
    Xi-Wu Zhang et al.
    The Journal of thoracic and cardiovascular surgery, 148(4), 1700-1708 (2014-04-08)
    Valve calcification involves transdifferentiation of valve interstitial cells (VICs) into osteoblasts. Twist-related protein 1 (TWIST1) has been established as a negative regulator of osteoblast differentiation in both mouse and human mesenchymal stem cells, but its function in human aortic VICs

    Contenu apparenté

    Tracer techniques using isotopic N have been employed since the 1940s to investigate such topics as N transformations and cycling in agricultural and other soils, N sources for crop uptake, the fate and behavior of fertilizer N applied to soils, the nature and extent of soil and fertilizer losses, and fertilizer N uptake efficiency.

    Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

    Contacter notre Service technique