Skip to Content
Merck

AV34374

Sigma-Aldrich

Anti-CRIP2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Cysteine-rich protein 2

Sign Into View Organizational & Contract Pricing

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

22 kDa

species reactivity

human, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CRIP2(1397)

General description

Cysteine-rich protein 2 (CRIP2) is a LIM-domain protein that can function as a transcriptional repressor of NF-κB-mediated expression of proangiogenic cytokines. Hence, CRIP2 can inhibit angiogenesis and cancer formation. It can also facilitate apoptosis in esophageal squamous cell carcinoma.
Rabbit Anti-CRIP2 recognizes bovine, human, mouse, and rat CRIP2.

Immunogen

Synthetic peptide directed towards the N terminal region of human CRIP2

Application

Rabbit Anti-CRIP2 can be used for western blot applications at a concentration of 1 μg/ml.

Biochem/physiol Actions

Human ESP1/CRP2 protein has two LIM domains, and each shares 35.1% and 77 or 79% identical residues with human cysteine-rich protein (CRP) and rat CRIP, respectively. Northern blot analysis of ESP1/CRP2 in various human tissues showed distinct tissue distributions compared with CRP and CRIP, suggesting that each might serve related but specific roles in tissue organization or function. Using a panel of human-rodent somatic cell hybrids, the ESP1/CRP2 locus was assigned to chromosome 14. Fluorescence in situ hybridization, using cDNA and a genome DNA fragment of the ESP1/CRP2 as probes, confirms this assignment and relegates regional localization to band 14q32.3.

Sequence

Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service