AV53618

Anti-ADAM7 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-ADAM metallopeptidase domain 7, Anti-EAPI, Anti-GP-83
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 83 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003808
• UniProt accession no.: Q9H2U9
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ADAM7(8756)

Description

General description

ADAM7 (ADAM metallopeptidase domain 7) gene encodes a single-pass type I membrane protein that belongs to ADAMs family of zinc proteases and is expressed in melanoma cells. It has a role in epididymosomes and is an integral plasma membrane protein in sperm that has unique secretory feature and interactive relationship during epididymis-to-sperm transfer process. Mutation in ADAM7 gene results in melanoma progression.

Immunogen

Synthetic peptide directed towards the C terminal region of human ADAM7

Application

Anti-ADAM7 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

Adam7 resides in an intracellular compartment of epididymal cells and is transferred to sperm membranes, where its levels are dependent on the expression of Adam2 and Adam3, which play critical roles in fertilization. It functions in fertilization through the formation of a chaperone complex and enhances association with integral membrane protein 2B (Itm2b) during capacitation in sperm. It also helps in the maturation of sperm cells in mammals and also plays a unique secretory feature and interactive relationship with sperm.

Sequence

Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable