Skip to Content
Merck
All Photos(4)

Key Documents

AV31855

Sigma-Aldrich

Anti-GATA2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-GATA binding protein 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

50 kDa

species reactivity

rabbit, rat, guinea pig, dog, bovine, human, horse, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GATA2(2624)

General description

GATA binding protein 2 (GATA2) is a transcription factor involved in the regulation of ematopoiesis wherein it is essential for the regulation of myeloid lineage determination. GATA2 is required for normal megakaryocyte development and it is a negative regulator of hematopoietic stem/progenitor cell differentiation. GATA2 is a novel poor prognostic marker in pediatric AML.
Rabbit polyclonal anti-GATA2 antibody reacts with canine, chicken, bovine, pig, human, mouse, and rat GATA binding protein 2 transcription factors.

Immunogen

Synthetic peptide directed towards the N terminal region of human GATA2

Application

Rabbit Anti-GATA2 antibody can be used for western blot assays (1-2μg/ml) and immunohistochemical (4-8μg/ml, using paraffin embedded tissues) applications.
Rabbit polyclonal anti-GATA2 antibody is used to tag GATA binding protein 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GATA binding protein 2 in myeloid lineage determination, megakaryocyte development and hematopoietic stem/progenitor cell differentiation.

Biochem/physiol Actions

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.

Sequence

Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Song Shen et al.
Molecular pharmaceutics, 11(8), 2612-2622 (2014-02-14)
Synthetic lethal interaction provides a conceptual framework for the development of wiser cancer therapeutics. In this study, we exploited a therapeutic strategy based on the interaction between GATA binding protein 2 (GATA2) downregulation and the KRAS mutation status by delivering

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service