Skip to Content
Merck
All Photos(2)

Key Documents

HPA014702

Sigma-Aldrich

Anti-ZDHHC20 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DHHC-20, Anti-Palmitoyltransferase ZDHHC20, probable, Anti-Zinc finger DHHC domain-containing protein 20

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20-1:50

immunogen sequence

SSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZDHHC20(253832)

General description

ZDHHC20 (zinc finger, DHHC-type containing 20) is a palmitoyl acyltransferase (PAT), and is a sequence homolog of yeast Pfa3. It resides in the plasma membrane. It is expressed in thyroid, liver, prostate, testis, placenta, colon, breast, kidney, brain, heart, lungs, thymus, leukocytes and ovaries. It contains the DHHC motif, the cysteine residue of which is essential for its catalytic function.

Immunogen

Palmitoyltransferase ZDHHC20, probable recombinant protein epitope signature tag (PrEST)

Application

Anti-ZDHHC20 antibody is suitable for immunostaining. Anti-ZDHHC20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ZDHHC20 (zinc finger, DHHC-type containing 20) is shown to plamitoylate myristoyl motif, present at the N-terminal. Palmitoylation of proteins such as, Src-related tyrosine kinases, results in cell proliferation mediated through cell signaling. In vitro studies show that this gene is up-regulated in multiple human cancer tissues, which promotes anchor-independent cell growth. Thus, this gene might hold potential as an anti-cancer therapeutic target. Its expression is altered in breast cancer, where it is involved in the control of cell cycle and cell migration. It might therefore, have therapeutic implications in triple negative breast cancer (TNBC).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73173

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Identifying a function for DHHC20 in breast cancer
Runkle K B
Cancer Research, 74(19), 3298-3298 (2014)
Wei Wang et al.
The Journal of biological chemistry, 290(25), 15707-15716 (2015-05-07)
Wnt5a signaling regulates polarized cell behavior, but the downstream signaling events that promote cell polarity are not well understood. Our results show that Wnt5a promotes depalmitoylation of the melanoma cell adhesion molecule (MCAM) at cysteine 590. Mutation of Cys-590 to
Akriti Kharbanda et al.
Biochemical and biophysical research communications, 493(1), 213-219 (2017-09-14)
Currently, there are no effective therapeutic strategies targeting Kras driven cancers, and therefore, identifying new targeted therapies and overcoming drug resistance have become paramount for effective long-term cancer therapy. We have found that reducing expression of the palmitoyl transferase DHHC20
Jeremiah M Draper et al.
Molecular membrane biology, 27(2-3), 123-136 (2010-03-26)
Palmitoylation is required for the activities of several cancer-associated proteins, making the palmitoyl acyltransferase (PAT) enzymes that catalyze these reactions potential targets for anticancer therapeutics. In this study, we sought to identify and characterize a human PAT with activity toward
Akriti Kharbanda et al.
Science signaling, 13(621) (2020-03-05)
Non-small cell lung cancer (NSCLC) is often characterized by mutually exclusive mutations in the epidermal growth factor receptor (EGFR) or the guanosine triphosphatase KRAS. We hypothesized that blocking EGFR palmitoylation, previously shown to inhibit EGFR activity, might alter downstream signaling

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service