SAB2104963

Anti-FAM135B antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-C8ORFK32, Anti-MGC126009, Anti-MGC126010, Anti-MGC33221
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 156 kDa
• species reactivity: human, guinea pig, bovine, mouse, horse, dog, rabbit, rat
• concentration: 0.5 mg - 1 mg/mL

Description

General description

FAM135B (family with sequence similarity 135 member B) gene is localized to human chromosome 8. This gene shows wide level of tissue expression, including heart and brain.[1]

Immunogen

Synthetic peptide directed towards the middle region of human FAM135B

Biochem/physiol Actions

FAM135B (family with sequence similarity 135 member B) is a new oncogene that facilitates malignancy in SCC (squamous cell carcinoma) cells and ESCC (esophageal SCC).[2][3] This gene participates in cell activity and signaling, including in brain. Polymorphism in this gene is linked with extrapulmonary tuberculosis.[1]

Sequence

Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable