추천 제품
생물학적 소스
human
재조합
expressed in E. coli
설명
0.1 mg of recombinant human CD40 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
무균
Filtered sterilized solution
분석
≥90% (SDS-PAGE)
양식
liquid
포장
pkg of 100 μg
농도
0.5 mg protein/mL
기술
cell culture | mammalian: suitable
수납 번호(accession number)
NP_690593
배송 상태
dry ice
저장 온도
−20°C
유전자 정보
human ... CD40LG(959)
애플리케이션
Coating a plate well (6 well plate) with this recombinant CD40 protein in neuronal cell specific medium at 1-10 μg/well (6 well plate) allows for 1) human neuronal cell / receptor interaction studies or 2) use as a culture matrix protein for human neuronal axon connection studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1.Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2.Add appropriate amount of diluted material to culture surface.
3.Incubate at room temperature for approximately 1.5 hours.
4.Aspirate remaining material.
5.Rinse plates carefully with water and avoid scratching bottom surface of plates.
6.Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1.Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2.Add appropriate amount of diluted material to culture surface.
3.Incubate at room temperature for approximately 1.5 hours.
4.Aspirate remaining material.
5.Rinse plates carefully with water and avoid scratching bottom surface of plates.
6.Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
서열
MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPLGAGL
제조 메모
The full-length extracellular domain of the human CD40 gene (54-608 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.