생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
44 kDa
종 반응성
rabbit, human, rat, bovine, mouse, guinea pig, dog, horse
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... ISGF3G(10379)
일반 설명
Interferon regulatory factor 9 (ISGF3G, IRF-9, p48) is a DNA-binding component of the heterotrimeric transcription factor ISGF3 which is activated by interferon-α and β (type I IFNs). The other two components of ISGF3 are STAT1 and STAT2. ISGF3 gamma or complexes containing ISGF3 gamma are involved in IRF-1-independent pathways mediating IFN gene regulation. ISGF3 plays a primary role in the transmission of a signal from the cell surface to the nucleus via regulatory factors p84/91 and p113.
Rabbit polyclonal anti-ISGF3G antibody reacts with pig, bovine, human, mouse, rat, and zebrafish interferon regulatory factor 9/ISGF3 gamma proteins.
면역원
Synthetic peptide directed towards the N terminal region of human ISGF3G
애플리케이션
Rabbit Anti-ISGF3G antibody can be used for western blotting applications at 2.5μg/ml.
Rabbit polyclonal anti-ISGF3G antibody is used to tag interferon regulatory factor 9/ISGF3 gamma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of interferon regulatory factor 9/ISGF3 gamma in the mediation of interferon-α and β (type I IFNs) signaling.
생화학적/생리학적 작용
ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.
서열
Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.