AV31855

Anti-GATA2 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-GATA binding protein 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 50 kDa
• 종 반응성: rabbit, rat, guinea pig, dog, bovine, human, horse, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_116027
• UniProt 수납 번호: P23769
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GATA2(2624)

설명

일반 설명

GATA binding protein 2 (GATA2) is a transcription factor involved in the regulation of ematopoiesis wherein it is essential for the regulation of myeloid lineage determination. GATA2 is required for normal megakaryocyte development and it is a negative regulator of hematopoietic stem/progenitor cell differentiation. GATA2 is a novel poor prognostic marker in pediatric AML.

Rabbit polyclonal anti-GATA2 antibody reacts with canine, chicken, bovine, pig, human, mouse, and rat GATA binding protein 2 transcription factors.

면역원

Synthetic peptide directed towards the N terminal region of human GATA2

애플리케이션

Rabbit Anti-GATA2 antibody can be used for western blot assays (1-2μg/ml) and immunohistochemical (4-8μg/ml, using paraffin embedded tissues) applications.

Rabbit polyclonal anti-GATA2 antibody is used to tag GATA binding protein 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GATA binding protein 2 in myeloid lineage determination, megakaryocyte development and hematopoietic stem/progenitor cell differentiation.

생화학적/생리학적 작용

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.

서열

Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable