추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
56 kDa
종 반응성
rabbit, rat, mouse, horse, guinea pig, human, dog
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PPARG(5468)
일반 설명
Peroxisome proliferator-activated receptor gamma/glitazone receptor (PPARG, NR1C3) is a type II nuclear receptor involved in the regulation of fatty acid storage and glucose metabolism. PPARG activation stimulates lipid uptake and adipocyte differention/adipogenesis. PPARG is a component of pathologies such as diabetes, atherosclerosis, and cancer. PPARG helps regulate the inflammatory response of endothelial cells.
Rabbit polyclonal anti-PPARG (AB1) antibody reacts with bovine, canine, human, mouse, rat, chicken, rabbit, and pig peroxisome proliferator-activated receptor gamma/glitazone receptors.
면역원
Synthetic peptide directed towards the N terminal region of human PPARG
애플리케이션
Rabbit Anti-PPARG has been used at a dilution of 1:50 for IHC applications. It can also be used for western blot at 1.25 μg/ml.
Rabbit polyclonal anti-PPARG (AB1) antibody is used to tag peroxisome proliferator-activated receptor gamma/glitazone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of peroxisome proliferator-activated receptor gamma/glitazone receptor in lipid and glucose metabolism, adipocyte differentiation and potential associated diseases such as diabetes, atherosclerosis, and cancer.
생화학적/생리학적 작용
PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.
서열
Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.