생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
29 kDa
종 반응성
mouse, rat, rabbit, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... KCNIP4(80333)
일반 설명
KCNIP4 is a protein member of the voltage-gated potassium (Kv) channel-interacting family. This protein is known to associate with calcium and presenilin. KCNIP4 has been implicated as a candidate gene for renal cancer, personality and attention-deficit/hyperactivity disorders (PD and ADHD), and asthma.
Rabbit Anti-KCNIP4 antibody recognizes human, mouse, rat, bovine, and canine KCNIP4.
Rabbit Anti-KCNIP4 antibody recognizes human, mouse, rat, bovine, and canine KCNIP4.
면역원
Synthetic peptide directed towards the N terminal region of human KCNIP4
애플리케이션
Rabbit Anti-KCNIP4 antibody is suitable for western blot (1.0 μg/ml) and IHC (4-8 μg/ml) applications.
생화학적/생리학적 작용
KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin.
서열
Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.