AV35242

Anti-TRPM5 (AB1) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-LTRPC5, Anti-MTR1, Anti-Transient receptor potential cation channel, subfamily M, member 5
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 131 kDa
• 종 반응성: mouse, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_055370
• UniProt 수납 번호: Q9NZQ8
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TRPM5(29850)

설명

일반 설명

TRPM5 is a Ca⁺-activated channel that is involved in the transduction of umami, sweet and bitter tastes. Voltage, temperature, acidic pH and phosphoinositides are known to modulate TRPM5 function. It regulates mucin secretion in colon and pheromone transduction in olfactory epithelia. TRPM5 has been studied as a target for obesity treatment.
Rabbit Anti-TRPM5 antibody recognizes human, canine, and mouse TRPM5.

면역원

Synthetic peptide directed towards the N terminal region of human TRPM5

애플리케이션

Rabbit Anti-TRPM5 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

생화학적/생리학적 작용

TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

서열

Synthetic peptide located within the following region: EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable