추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
40 kDa
종 반응성
guinea pig, dog, rat, bovine, horse, human, mouse, rabbit
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... KCNAB2(8514)
일반 설명
Potassium voltage-gated channel subfamily A regulatory beta subunit 2 (KCNAB2), an ion channel gene, codes for a voltage?gated K+ channel β?subunit protein, Kvβ2. This gene is located on human chromosome 1p36. Kvβ2 is expressed ubiquitously in the human heart. It belongs to the aldo?keto reductase superfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-α subunits.
면역원
Synthetic peptide directed towards the middle region of human KCNAB2
생화학적/생리학적 작용
Potassium voltage-gated channel subfamily A regulatory β subunit 2 (KCNAB2) gene is involved in neuroendocrine conditions KCNAB2 serves as a candidate gene for epilepsy. A cardiac arrhythmia disorder, called Brugada syndrome occurs due to the gain-of-function mutation in KCNAB2 gene. Voltage-gated potassium (Kv) channels play a key role in modulating the contraction of smooth muscle, secretion of insulin, the release of neurotransmitters, and excitability of the neuron. It also participates in heart rate, epithelial electrolyte transport, and cell volume.
서열
Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.