AV44249

Anti-PTCH1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Patched homolog 1 (Drosophila)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 37 kDa
• 종 반응성: dog, bovine, horse, human, mouse, guinea pig, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_001077072
• UniProt 수납 번호: Q6TKP8
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PTCH1(5727)

설명

일반 설명

Protein patched homolog 1 (PTCH1) is the receptor for secreted sonic hedgehog ligand and belongs to the patched gene family. It is mapped to human chromosome 9q22.32. Ptch1 has 12 transmembrane regions, intracellular middle-loop domain (MLD) and C-terminal domain (CTD) essential for oligomerization.

면역원

Synthetic peptide directed towards the C terminal region of human PTCH1

애플리케이션

Anti-PTCH1 antibody produced in rabbit has been used in Flow cytometry/Cell sorting. It is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)

생화학적/생리학적 작용

Mutations in protein patched homolog 1(PTCH1) is implicated in autosomal dominant disorder called the Gorlin syndrome, resulting in developmental abnormalities.

PTCH1 (patched 1; PTC) activates the sonic hedgehog (Hh) signaling pathway that is involved in the development of embryonic structures. PTCH1 is a tumor suppressor that maintains the activity of GLI1, the downstream target of Hh signaling. Mutations and methylation status in PTCH1 gene result in tumorigenesis and malignancy in cancers including colorectal, gastric, melanoma and osteosarcoma.

서열

Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable