AV47093

Anti-SV2A antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-KIAA0736, Anti-SV2, Anti-Synaptic vesicle glycoprotein 2A
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 분자량: 83 kDa
• 종 반응성: human, guinea pig, mouse, bovine, horse, dog, rabbit, rat
• 포장: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_055664
• UniProt 수납 번호: Q7L0J3
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SV2A(9900)

설명

면역원

Synthetic peptide directed towards the middle region of human SV2A

애플리케이션

Anti-SV2A antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

생화학적/생리학적 작용

SV2A (synaptic vesicle glycoprotein 2A) gene is a multi-pass membrane protein that belongs to major facilitator superfamily. It regulates the cytoplasmic Ca²⁺ levels in the nerve terminal during repetitive stimulation and facilitates the synaptic transmission. SV2A serves as a binding site for the antiepileptic drug levetiracetam and may decrease the neuronal excitability. Mutation in SV2A gene results in schizophrenia.

서열

Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable