AV54780

Anti-LOXL1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-LOL, Anti-LOXL, Anti-Lysyl oxidase-like 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 63 kDa
• 종 반응성: guinea pig, mouse, rat, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_005567
• UniProt 수납 번호: Q08397
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LOXL1(4016)

설명

면역원

Synthetic peptide directed towards the N terminal region of human LOXL1

애플리케이션

Anti-LOXL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

The encoded protein belongs to lysyl oxidase gene family and is mapped on to chromosome 15 at 15q24-q25. It is an extracellular protein with elastin and collagen as the chief substrates. It plays a crucial role in oxidizing the epsilon (ε) amino group in lysine to produce an aldehyde group. Lysyl oxidases are copper amine oxidases that facilitate the biogenesis of connective tissue by initiating the covalent crosslinking between collagens and elastin. Defect in LOXL1 gene expression is associated with exfoliation disease development.

서열

Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable