HPA014561

Anti-TMEM30A antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-C6orf67, Anti-CDC50A, Anti-FLJ10856, Anti-transmembrane protein 30A
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA014561
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:50-1:200
• 면역원 서열: VKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFI
• UniProt 수납 번호: Q9NV96
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TMEM30A(55754)

설명

일반 설명

TMEM30A (transmembrane protein 30A) is a functional homolog of Saccharomyces cerevisiae Lem3p protein. It has the conserved sequence QNHRRYVKS and is a transmembrane protein. The corresponding mRNA has a wide range of tissue expression. In cells expressing high level of TMEM30A, a major portion of this protein localizes to organelles such as, mitochondria, endoplasmic reticulum (ER) and Golgi bodies. This gene is localized to human chromosome 6q14.1, and encodes a protein composed of 361 amino acids. TMEM30A is also called CDC50A (cell division cycle protein 50A) and is a member of CDC50 family, which in humans includes- CDC50A, CDC50B and CDC50C.

면역원

transmembrane protein 30A recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

TMEM30A (transmembrane protein 30A) forms a heterodimeric complex with ATP8B1 P-type ATPase, and has a role in phospholipid import system. Extracellular choline phospholipids with short sn-2 residues act as substrates for this protein. It also forms a phospholipid flippase complex with ATP8A1, and facilitates the transfer of phosphatidylethanolamine to the cell membrane. This complex also enhances cell migration by facilitating the formation of membrane ruffles. Under-expression of TMEM30A leads to the exposure of phosphatidylserine on the outer leaflet of cell membrane, which acts as a signal to macrophages to phagocytose the particular cell. It also facilitates the uptake of antitumor drug perifosine by human cancer cells, most probably by association with P4-ATPase. It is a putative chaperone or β-subunit for ATP8B1 in hepatocytes. It also plays a role in the transport of ATP8B1 to plasma membrane, and thus, might be linked with ATP8B1-related disorders.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72841

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable