추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PTK6(5753)
일반 설명
PTK6 (protein tyrosine kinase 6) belongs to intracellular tyrosine kinases family. It is normally expressed in epithelial cells of skin, gastrointestinal tract and prostate. It is also called as breast tumor kinase (brk), for its critical role in progression of breast cancer. The PTK6 gene is located on the human chromosome 20q13.33. PTK6 protein is expressed in two isoforms.
면역원
PTK6 protein tyrosine kinase 6 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-PTK6 rabbit polyclonal antibody has been used in microarray analysis of PTK6 in breast tumor samples. It may also be used to detect protein tyrosine kinase 6 using western blot analysis in esophageal squamous cell carcinoma.
생화학적/생리학적 작용
Protein tyrosine kinase 6 regulates epithelial cell gene expression by modulating RNA binding proteins. It favours epidermal growth factor receptor signalling cascade. Mutations in kinase domain leads to activity suppression. PTK6 is effectively inhibited by tumor suppressor protein phosphatase and tensin homolog (PTEN) in human prostate cancer tissues and cell lines. PTK6 is highly expressed and up-regulated in a multitude of human carcinomas including hepatocellular carcinoma, cervical squamous carcinoma, prostate cancer and colon cancer. PTK6 mediates proteasome-mediated degradation of tumor suppressor protein by phosphorylation. With the advent of its association in human cancer, PTK6 is considered as a potential drug target for cancer chemotherapy.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST78020
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.