콘텐츠로 건너뛰기
Merck
모든 사진(10)

주요 문서

SAB1400121

Sigma-Aldrich

Monoclonal Anti-HDAC1 antibody produced in mouse

clone 5C11, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-DKFZp686H12203, Anti-GON10, Anti-HD1, Anti-RPD3, Anti-RPD3L1

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

5C11, monoclonal

양식

buffered aqueous solution

종 반응성

human, rat, mouse

기술

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

동형

IgG1κ

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HDAC1(3065)

일반 설명

Histone deacetylase 1 (HDAC1) is mainly expressed in the nucleus. It belongs to class I of histone deacetylases and the gene encoding it is localized on human chromosome 1p35.2.

면역원

HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

생화학적/생리학적 작용

Histone deacetylase 1 (HDAC1) is an epigenetic factor. It is part of the innate antiviral response. The protein has roles in DNA repair, splicing, regulation of gene expression and cell division. It deacetylates lysine residues of histone H3 and H4. HDAC1 has been shown to have a role in various cancers.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

DNA copy number profiling reveals different patterns of chromosomal instability within colorectal cancer according to the age of onset
Maria Arriba
Molecular Carcinogenesis (2015)
Histone deacetylase HDAC1 expression correlates with the progression and prognosis of lung cancer: A meta-analysis.
Cao LL
Medicine (2017)
Influenza A Virus Dysregulates Host Histone Deacetylase 1 That Inhibits Viral Infection in Lung Epithelial Cells.
Nagesh PT and Husain M
Journal of Virology (2016)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.