SAB1401214

Anti-IL12RB1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• 동의어(들): CD212, IL-12R-BETA1, IL12RB, MGC34454
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: BC029121
• UniProt 수납 번호: P42701
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IL12RB1(3594)

설명

일반 설명

IL12RB1 (interleukin 12 receptor subunit β1) gene is mapped to human chromosome 19p13.11. The encoded protein is a member of type I transmembrane receptors.

Rabbit polyclonal antibody raised against a full-length human IL12RB1 protein.

면역원

IL12RB1 (AAH29121.1, 1 a.a. ~ 381 a.a) full-length human protein.

Sequence
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

생화학적/생리학적 작용

IL12RB1 (interleukin 12 receptor subunit β1) regulates the physiological responses to a number of diseases. IL12RB1 binds to both IL 12 (interleukin 12) and IL 23 (interleukin 23) at a common binding point 12p40-domain.Variation in the gene affects the receptor sensitivity towards the cytokines IL 12 and IL 23. Thus, the gene is associated with the diseases that are regulated by IL 12 and IL 23. Susceptibility to diseases such as tuberculosis, nontuberculous mycobacterial infection, malaria, cancer, pediatric asthma, and atopic dermatitis is related to IL12RB1.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable