SAB1402157

Monoclonal Anti-CRY2 antibody produced in mouse

clone 3H4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): FLJ10332, HCRY2, KIAA0658, PHLL2
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3H4, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~36.12 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_021117
• UniProt 수납 번호: Q49AN0
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CRY2(1408)

설명

일반 설명

Cryptochrome circadian regulator 2 (CRY2) is a core circadian gene and transcriptional repressor. CRY2 gene is located on the human chromosome 11p11.2.

면역원

CRY2 (NP_066940.1, 141 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG

생화학적/생리학적 작용

Cryptochrome circadian regulator 2 (CRY2) is involved in DNA damage checkpoint control and cell cycle progression. It maintains the circadian rhythm through a circadian feedback loop. It is also important in immune system coordination and hematologic system development. CRY2 is a potential circadian biomarker for non-Hodgkin′s lymphoma (NHL). CRY2 is linked to rapid cycling in bipolar disorder. CRY2 functions as light-sensitive magnetosensor.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable