추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
6F7, monoclonal
양식
buffered aqueous solution
분자량
antigen ~38.21 kDa
종 반응성
mouse, human, rat
기술
capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RIPK2(8767)
관련 카테고리
일반 설명
Receptor interacting serine/threonine kinase 2 (RIPK2) belongs to the RIP kinase family. The protein contains a caspase activation and recruitment domain (CARD) at the C-terminal, N-terminal kinase domain, and a bridging intermediate domain. The gene is mapped to human chromosome 8q21.3.
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. (provided by RefSeq)
면역원
RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
애플리케이션
Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse has been used in immunoblotting (1:500).
생화학적/생리학적 작용
Receptor interacting serine/threonine kinase 2 (RIPK2) is a key regulator of the immune and inflammatory pathways. It is a potent activator of nuclear factor (NF)-κB via nucleotide-binding and oligomerization domain (NOD) receptor. RIPK2 is associated with the progression and aggressiveness, tumor size, metastasis, and overall stagging in various types of cancers. Overexpression of RIPK2 is observed in the head and neck squamous cell carcinoma (HNSCC), gastric cancer, colorectal cancer (CRC), and lethal prostate cancers. It is found to induce cell proliferation and inhibit apoptosis in glioma and breast cancer. RIPK2 polymorphism is also associated with the onset of bladder cancer.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.