SAB5702092

Anti-Cathepsin B Antibody, clone 6I5D7, Rabbit Monoclonal

• 동의어(들): APPS,CPSB,Cathepsin B,CTSB
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 6I5D7, monoclonal
• 양식: liquid
• 분자량: 44 kDa
• 종 반응성: human
• 농도: 0.80 mg/mL
• 기술: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: SDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
• UniProt 수납 번호: P07858
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CTSB(1508)

설명

일반 설명

This gene encodes a member of the C1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to form the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer's disease, the most common cause of dementia. Overexpression of the encoded protein has been associated with esophageal adenocarcinoma and other tumors. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Nov 2015]

면역원

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 27-156 of human Cathepsin B (P07858).

애플리케이션

WB, IHC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1