SAB5702551

Anti-MAP Kinase- ERK1/ERK2 Antibody

rabbit monoclonal, 2Z8O1

• 동의어(들): ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK, 5594/5595
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• Product Name: Anti-ERK1/2 Antibody, clone 2Z8O1, Rabbit Monoclonal,
• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 2Z8O1, monoclonal
• 양식: liquid
• 종 반응성: rat, rat, human
• 농도: 0.25 mg/mL
• 기술: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:1000 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
• UniProt 수납 번호: P27361; P28482
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MAPK1(5594), MAPK3(5595)

설명

일반 설명

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

면역원

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK1/2 (P28482).

애플리케이션

WB, IHC, IF/ICC, IP

안전성 정보

• 픽토그램: GHS07,GHS09
• 신호어: Warning
• 유해 및 위험 성명서: H317,H411
• 예방조치 성명서: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3