콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

WH0000196M2

Sigma-Aldrich

Monoclonal Anti-AHR antibody produced in mouse

clone 3B12, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-aryl hydrocarbon receptor

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

3B12, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

동형

IgG1κ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... AHR(196)

일반 설명

Aryl hydrocarbon receptor (Ahr) is a helix-loop-helix transcription factor and a heterodimeric protein. It is encoded by the gene mapped to human chromosome 7p211. The encoded protein is a member of the helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) family of transcription factors. AHRis mainly expressed in the cytoplasm and is found in a complex with chaperone proteins such as HSP90 (heat shock protein 90), XAP2 (X-associated protein 2 ) and p23 (cochaperone for the Hsp90).
This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. (provided by RefSeq)

면역원

AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN

애플리케이션

Monoclonal Anti-AHR antibody produced in mouse has been used in western blot technique.

생화학적/생리학적 작용

Aryl hydrocarbon receptor (Ahr) helps in the inhibitory effects of 2-(4-hydroxy-3-methoxyphenyl)-benzothiazole (YL-109) on development and invasion of MDA-MB-231 (breast adenocarcinoma cell line) by upregulation of heat shock protein 70 (Hsp70)-interacting protein (CHIP). The encoded protein regulates invasiveness and metastasis of breast cancer cells. Ahr mediates various biological responses to extensive environmental pollutants.

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.