콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

WH0003576M5

Sigma-Aldrich

Monoclonal Anti-IL8 antibody produced in mouse

clone 6G4, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-CXCL8, Anti-GCP1, Anti-Interleukin 8, Anti-K60, Anti-NAP1, Anti-SCYB8, Anti-TSG1

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

6G4, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2aκ

GenBank 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... IL8(3576)

일반 설명

Interleukin-8 (IL-8)/CXCL8 is an important chemoattractant cytokine and activator of neutrophils. It is liberated from endothelial cells, gingival fibroblasts, neutrophils, monocytes and phagocytes in the gingival crevice. IL-8 belongs to the CXC subfamily. This gene is located on human chromosome 4q13.3.
The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. (provided by RefSeq)

면역원

IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

생화학적/생리학적 작용

Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.
Interleukin-8 (IL-8)/CXCL8 participates in the progression of peripheral muscle weakness in individuals with COPD (chronic obstructive pulmonary disease). It helps in the transport of neutrophils across endothelium, pulmonary epithelium and fibroblasts. CXCL8 induces adhesion of neutrophils to extracellular matrix proteins and cytokine-stimulated endothelial monolayers via interaction with CD11b/CD18 (β2-integrins).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.