SAB1411514

Anti-MAP1LC3A antibody

rabbit polyclonal

• Synonym(s): LC3, LC3A, MAP1ALC3, MAP1BLC3
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• Product Name: Anti-MAP1LC3A antibody produced in rabbit, purified immunoglobulin, buffered aqueous solution
• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 13.31 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: BC015810.1
• UniProt accession no.: Q9H492
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MAP1LC3A(84557)

Description

General description

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

MAP1LC3A (AAH15810.1 , 1 a.a. ~ 121 a.a) full-length human protein.

Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable