SAB1411699
Anti-GINS1 antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonym(s):
KIAA0186, PSF1
Select a Size
₩229,898
Select a Size
About This Item
₩229,898
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
antigen 21.67 kDa
species reactivity
human
technique(s)
western blot: 1 μg/mL
1 of 4
This Item | Z324965 | Z325384 | Z325090 |
|---|---|---|---|
| manufacturer/tradename BRAND 29727 | manufacturer/tradename BRAND 29707 | manufacturer/tradename BRAND 29738 | manufacturer/tradename BRAND 29718 |
| capacity 5 mL | capacity 5 mL | capacity 50 mL | capacity 50 mL |
| feature class AS | feature class AS | feature class AS | feature class AS |
| material AR-Glas® | material AR-Glas® | material AR-Glas® | material AR-Glas® |
| packaging pack of 6 ea | packaging pack of 6 ea | packaging pack of 6 ea | packaging pack of 6 ea |
| description partial delivery | description total delivery Ex + 15 sec waiting time | description partial delivery | description total delivery Ex + 15 sec waiting time |
General description
Immunogen
Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Physical form
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Articles
Sigma-Aldrich.com presents an article regarding Polyethylene Glycol Building Blocks for PEGylation.
Professor Randal Lee (University of Houston, USA) discusses design considerations for iron oxide magnetic nanospheres and nanocubes used for biosensing, including synthetic procedures, size, and shape. The effects of these variables are discussed for various volumetric-based and surface-based detection schemes.
Kanjiro Miyata (The University of Tokyo, Japan) provides insights on the rational design of polymeric materials for “smart” oligonucleotide delivery.
Devising biomaterial scaffolds that are capable of recapitulating critical aspects of the complex extracellular nature of living tissues in a threedimensional (3D) fashion is a challenging requirement in the field of tissue engineering and regenerative medicine.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service