SAB1411922
ANTI-PPARGC1A antibody produced in mouse
clone 2F9, purified immunoglobulin, buffered aqueous solution
Synonym(s):
LEM6, PGC-1(alpha), PGC-1v, PGC1, PPARGC1A
Select a Size
₩901,320
Select a Size
About This Item
₩901,320
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2F9, monoclonal
form
buffered aqueous solution
mol wt
antigen 37.84 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
1 of 4
This Item | WH0010891M3 | SAB2108742 | SAB4300858 |
---|---|---|---|
antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
Gene Information human ... PPARGC1A(10891) | Gene Information human ... PPARGC1A(10891) | Gene Information human ... PPARGC1A(10891) | Gene Information human ... PPARGC1B(133522) |
biological source mouse | biological source mouse | biological source rabbit | biological source rabbit |
clone 2F9, monoclonal | clone 1F3, monoclonal | clone polyclonal | clone polyclonal |
conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate - |
species reactivity human | species reactivity human | species reactivity dog, human, guinea pig, rat | species reactivity human |
General description
Immunogen
Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Biochem/physiol Actions
Physical form
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service