Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

AV40568

Sigma-Aldrich

Anti-PCBP2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Poly(rC) binding protein 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

40 kDa

species reactivity

mouse, horse, bovine, rat, guinea pig, human

concentration

0.5 mg - 1 mg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
EMU038431EMU001561EMU002151
Gene Information

mouse ... CSF2RA(12982), Csf2ra(12982)

Gene Information

mouse ... CRYZ(12972), Cryz(12972)

Gene Information

mouse ... CSK(12988), Csk(12988)

Gene Information

mouse ... TMEM138(72982), Tmem138(72982)

esiRNA cDNA target sequence

TGAAGCGATGCTGATAGACGTCATCGTGACCGCTCCCCACCCCCACGTCTGGTGTGACTGGACCCCTGTTGCCCTGTTCATCAATCACCAAAGTGGGCGTGTCCAGTCTCATCCTGTCAATCACCCTGGAAGGGCATGTTTAACGACATTGATGTCACCGTGATATCACAGTCCAACCAAATCCTCCTCTATAGCCCCGCCCACCCCGACAGGAAGCACAGGTGACTGGGAAGCCTGCCACTGTCAATCAAGGCCGCCCATCCCAAAAAAATCAGTACTCGTGGCCATCCTCCTGCCTCAGTTCCAGGGATGGCAGGGACAGCGTGCATATCCCCACCGTAATAGTTTGCTCAGTTCTTAACAAACCCTAACCCTTAATATTTTACCTTAACAGCCAGCACACACACA

esiRNA cDNA target sequence

ACAAGCATCATTGGGGTCTCTCTCTCTTCTTCCACCAAGGAGGAATTTCAACAATTCGCAGGCCTTCTCCAAGCAGGAATAGAAAAAGGTTGGGTGAAACCTGTGATAGGTTCTGAGTATCCATTGGAGAAAGCAGCCCAGGCCCACGAAGATATCATTCACGGCAGTGGGAAGACGGGGAAAATGATTCTCCTCTTATGAGACCTGTGTCACTGGGCTCCTTCTTCCTCAAGTCTCTGCACCACCATCTTTAAACAGTGTTATTTGATTGAGGTTCACGTATTAAAAACAGGACTTTAGGGAGTAGACACAGTGAGTGACATAATTGCAGAGAGCAGGTGTGCCCAATGGGGTCTGCGTGCATCACAAAACTCTTTTCTTCCTTTTTCTTCATTTTCTTAGTTTGGTTGGATGTTTTTGTTTTGTGCTTGAGACAGGATCATTCTCTGTAGTTCATGCTGGCCGTGAACTCACAGTGATCTTTCTGCCTCAGCCGTCTAAAT

esiRNA cDNA target sequence

TGAGCATTGATGAGGAGGTGTACTTTGAGAACCTCATGCAGCTGGTGGAGCACTACACCACAGATGCCGATGGACTCTGCACTCGCCTCATCAAACCAAAGGTCATGGAGGGCACCGTGGCGGCCCAGGATGAGTTCTACCGCAGTGGCTGGGCACTGAACATGAAGGAACTGAAGCTGCTACAGACAATAGGGAAGGGGGAGTTTGGAGATGTGATGCTGGGGGATTACCGGGGCAACAAAGTTGCAGTCAAGTGCATCAAGAATGACGCAACTGCCCAGGCCTTCCTGGCTGAAGCCTCCGTCATGACGCAACTTCGGCACAGCAACCTCGTCCAGCTGCTGGGTGTGATTGTGGAGGAGAAGGGTGGGCTCTACATCGTCACAGAGTACATGGCCAAGGG

esiRNA cDNA target sequence

TCCGAATGGCTCCTGTTATCCAGCTTGTGCTGTTCATCATCCAGGATATTGCAATCCTCTTCAACATCATCATAATTTTCCTCATGTTCTTCAACACCTTCGTCTTCCAGGCTGGCCTGGTCAACCTCCTTTTCCATAAGTTCAAAGGGACCATCATTCTGACATCTGTGTACCTTGCCCTCAGCATCTCCCTACATGTCTGGGTCATGAACGTGCGATGGAAAAACTCCAGCAGCTTCAGCTGGACAAACGGCCTGCAAACACTGTTTGTATTCCAGAGACTAGCCGCAGTGCTCTACTGCTATTTCTACAAAAGGACGGCCGTGAGACTGGGTGACCCCCGCTTTTACCAGGACTCACTGTGGCTTCGCAAGGAGTTCATGCAAGTCCGAAGGTGACCACT

Ensembl | mouse accession no.

ENSMUSG00000059326

Ensembl | mouse accession no.

ENSMUSG00000028199

Ensembl | mouse accession no.

ENSMUSG00000032312

Ensembl | mouse accession no.

ENSMUSG00000024666

product line

MISSION®

product line

MISSION®

product line

MISSION®

product line

MISSION®

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

NCBI accession no.

NM_009970

NCBI accession no.

NM_009968

NCBI accession no.

NM_007783

NCBI accession no.

NM_028411

General description

Poly(rC) binding protein 2 (PCBP2) is a poly(rC)-binding protein that regulate of RNA processing. PCBP2 is believed to be involved in the shuttling of nascent mRNPs to processing bodies (P-bodies) which are involved in mRNA degradation and siRNA- or miRNA-mediated gene silencing. PCBP2 promotes the processing of various microRNAs (miRNA) via its association with Dicer. MicroRNA processing may be regulated by cytosolic iron via the PCBP2:Dicer-dependent processes. The PCBP2-AIP4 axis defines a signaling cascade for MAVS degradation and ′fine tuning′ of antiviral innate immunity. PCBP2 stabilization of mRNA increases the expression of STAT1 and STAT2 which enhances the antiviral effect of IFN-α.

Specificity

Anti-PCBP2 (AB1) polyclonal antibody reacts with poly(rC) binding protein 2 proteins.

Immunogen

Synthetic peptide directed towards the middle region of human PCBP2

Application

Anti-PCBP2 (AB1) polyclonal antibody is used to tag poly(rC) binding protein 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of poly(rC) binding protein 2 in RNA trafficking and processing.

Biochem/physiol Actions

PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5′-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5′-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.

Sequence

Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


  • Choose from one of the most recent versions:

    Certificates of Analysis (COA)

    Lot/Batch Number

    Don't see the Right Version?

    If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

    Already Own This Product?

    Find documentation for the products that you have recently purchased in the Document Library.

    Visit the Document Library

    Yujie Liu et al.
    Molecular and cellular biology, 34(21), 3993-4007 (2014-08-27)
    T-regulatory (Treg) cells are important to immune homeostasis, and Treg cell deficiency or dysfunction leads to autoimmune disease. A histone/protein acetyltransferase (HAT), p300, was recently found to be important for Treg function and stability, but further insights into the mechanisms

    Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

    Contact Technical Service