Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV41591

Sigma-Aldrich

Anti-VSIG4 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-V-set and immunoglobulin domain containing 4, Anti-Z39IG

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

pig, human, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... VSIG4(11326)

General description

Adaptive immune response involving activated lymphocytes requires the engagement of T-cell receptors by antigenic peptide-MHC complexes (APC). B7 family members are involved in the regulation of T-cell activation by APCs. V-set and immunoglobulin domain containing 4 (VSIG4, Z39IG), a B7 family-related protein, has been identified as a negative regulator of T-cell activation. VSIG4 may play a role in inhibiting processes such as interstitial fibrosis.

Specificity

Anti-VSIG4 polyclonal antibody reacts with bovine, human, mouse, and rat V-set and immunoglobulin domain containing 4 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human VSIG4

Application

Anti-VSIG4 polyclonal antibody is used to tag V-set and immunoglobulin domain containing 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of V-set and immunoglobulin domain containing 4 as a negative regulator of T-cell activation during adaptive immune response.

Biochem/physiol Actions

T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Sequence

Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qian Qiao et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 28(11), 4986-4999 (2014-08-13)
The inappropriate activation of complement may contribute to various immune diseases. The alternative pathway (AP) predominates during complement activation regardless of the initiating pathways. Hence, the main AP regulator factor H (FH) holds great potential as an attractive therapeutic intervention.
Yunmei Liao et al.
Laboratory investigation; a journal of technical methods and pathology, 94(7), 706-715 (2014-05-28)
Tumor-associated macrophages are a prominent component of lung cancer stroma and contribute to tumor progression. The protein V-set and Ig domain-containing 4 (VSIG4), a novel B7 family-related macrophage protein that has the capacity to inhibit T-cell activation, has a potential

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service