Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

HPA009263

Sigma-Aldrich

Anti-MAPRE3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-EB1 protein family member 3 antibody produced in rabbit, Anti-EB3 antibody produced in rabbit, Anti-EBF3 antibody produced in rabbit, Anti-End-binding protein 3 antibody produced in rabbit, Anti-Microtubule-associated protein RP/EB family member 3 antibody produced in rabbit, Anti-RP3 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

YDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MAPRE3(22924)

General description

MAPRE3 (microtubule associated protein RP/EB family member 3), also called EB3, is a member of the EB (end-binding) protein family, which function as microtubule plus-end tracking proteins. This family consists of three proteins- EB1, 2 and 3 (MAPRE3). These proteins are composed of a calponin homology domain in their N-terminal, through which they track microtubule tips. They form dimers through their C-terminal coiled coil domains. MAPRE3 shows a ubiquitous expression pattern, and resides in centrosomes and mitotic spindle during mitosis.

Immunogen

Microtubule-associated protein RP/EB family member 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

MAPRE3 (microtubule associated protein RP/EB family member 3) forms dimers with EB1 (end binding) protein, and plays essential role during cell division. It is responsible for focal adhesion stabilization and spreading of daughter cells during the end of mitosis. It facilitates stabilization of midbody microtubules thus, ensuring efficient cytokinesis. Hypermethylation of MAPRE3 resulting in its suppression leads to the pathogenic effects of TGF (tumor growth factor) β and RASFs (rheumatoid arthritis (RA) synovial fibroblasts). Both of these play integral part in the pathogenesis of RA. This protein is phosphorylated by vascular endothelial (VE)-cadherin, which results in inhibition of microtubule growth and assembly of adherens junctions.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71202

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Indrani Sen et al.
PloS one, 8(9), e74448-e74448 (2013-09-17)
End binding (EB) proteins are responsible for the recruitment of an array of microtubule plus-end tracking proteins (+TIPs) to growing microtubules ends. EBs encompass an N-terminal calponin homology domain that confers microtubule tip tracking activity to the protein. The C-terminal
Sung-Hoon Park et al.
Molecules and cells, 35(4), 298-304 (2013-03-05)
Rheumatoid arthritis (RA) is a chronic, systemic inflammatory disease of unknown origin, which exhibits a complex heterogeneity in its pathophysiological background, resulting in differential responses to a range of therapies and poor long-term prognosis. RA synovial fibroblasts (RASFs) are key
Jorge G Ferreira et al.
The Journal of cell biology, 201(5), 709-724 (2013-05-29)
During mitosis, human cells round up, decreasing their adhesion to extracellular substrates. This must be quickly reestablished by poorly understood cytoskeleton remodeling mechanisms that prevent detachment from epithelia, while ensuring the successful completion of cytokinesis. Here we show that the
Ivane Abiatari et al.
International journal of oncology, 35(5), 1111-1116 (2009-09-30)
Perineural invasion of tumor cells is a characteristic feature of human pancreatic cancer. Unrevealing the molecular mechanisms that enable cancer cells to invade and grow along nerves is important for the development of novel therapeutic strategies in this disease. We
Yulia A Komarova et al.
Molecular cell, 48(6), 914-925 (2012-11-20)
Vascular endothelial (VE)-cadherin homophilic adhesion controls endothelial barrier permeability through assembly of adherens junctions (AJs). We observed that loss of VE-cadherin-mediated adhesion induced the activation of Src and phospholipase C (PLC)γ2, which mediated Ca(2+) release from endoplasmic reticulum (ER) stores

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service