Skip to Content
MilliporeSigma
All Photos(8)

Key Documents

HPA011155

Sigma-Aldrich

Anti-LAIR1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CD305 antigen, Anti-LAIR-1, Anti-Leukocyte-associated immunoglobulin-like receptor 1 precursor, Anti-hLAIR1

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LAIR1(3903)

General description

Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a transmembrane glycoprotein which is a part of the leukocyte receptor complex (LRC)-encoded family. In its cytoplasmic domain, it contains two immunoreceptor tyrosine-based inhibition motifs (ITIMs). It is widely expressed on immune cells such as B cells, T cells, natural killer (NK) cells, monocytes, dendritic cells and CD34+ hematopoietic progenitor cells. LAIR-1 gene maps to human chromosome 19q13.4, and codes for a type I transmembrane protein, consisting of 287 amino acids. It has one C2-type Ig-like domain in its exoplasmic region. This gene contains 10 exons, and alternative splicing gives rise to many isosforms such as, LAIR-1a, LAIR-1b, LAIR-1c and LAIR-1d.

Immunogen

Leukocyte-associated immunoglobulin-like receptor 1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) suppresses the cytotoxic activity of natural killer (NK) cells, and also inhibits the differentiation of blood precursor cells into dendritic cells. It interacts with CD3 and prevents the cytotoxicity of effector T-cells. It cross links with B-cells, and prevents B-cell receptor (BCR)-induced calcium mobilization, as well as inhibition of immunoglobulin (Ig) and cytokine production. It inhibits protein kinase B (PKB) activation and granulocyte-macrophage colony-stimulating factor (GM-CSF)-dependent proliferation of leukemia cells. It might be involved in the regulation of immune response by extracellular matrix (ECM), by interacting with collagen, which leads to suppression of immune response. In rheumatoid arthritis (RA) patients, LAIR-1 is expressed on macrophages of inflamed synovial tissue. It prevents osteoclastogenesis, which might be useful for designing therapy for RA. It is also involved in the proliferation and invasion of epithelial ovarian cancer cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72187

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service