MSST0010
SILu™Lite MAPK1 Mitogen Activated Protein Kinase 1 human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Synonym(s):
Extracellular signal-regulated kinase 2 (Erk2), Mitogen-activated protein kinase 1 (MAPK1)
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
23201100
NACRES:
NA.12
Recommended Products
Related Categories
General description
SILu™Lite MAPK1 is a recombinant human MAPK1 expressed in human 293 cells. It is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa. SILu™Lite MAPK1 is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry.
Biochem/physiol Actions
MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.
Sequence
MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Physical form
Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
signalword
Warning
hcodes
Hazard Classifications
Eye Irrit. 2
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service