SAB1400074

Anti-DDOST antibody produced in mouse

IgG fraction of antiserum, aqueous glycerol solution

• Synonym(s): Anti-KIAA0115, Anti-OST, Anti-OST48
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: aqueous glycerol solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: suitable
• UniProt accession no.: P39656
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DDOST(1650)

Description

General description

This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia. (provided by RefSeq)

Immunogen

DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag.

Sequence
TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Physical form

Solution

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable