SAB1402026
Anti-DPPA2 antibody produced in mouse
purified immunoglobulin, buffered aqueous solution
Synonym(s):
PESCRG1
About This Item
1 of 4
This Item | SAB2100623 | SAB1410530 | SAB1400607 |
---|---|---|---|
biological source mouse | biological source rabbit | biological source rabbit | biological source mouse |
conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form purified immunoglobulin | antibody form IgG fraction of antiserum |
species reactivity human | species reactivity human | species reactivity human, rat | species reactivity human |
storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
Immunogen
Sequence
MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
Physical form
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service